SecReT6
Protein ID: 386612398
SecReT6 ID631
T6SS typei1
Gene symbol-
Locus tagUMNK88_247
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]264038..265966 [+]
Producttype IV secretion protein VgrG
NoteTssI
UniProt IDF4M3M7
KEGG IDeun:UMNK88_247
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-56, Aligned region: 2..257
Phage_base_V [PF04717], Evalue: 3.70E-27, Aligned region: 295..387
Protein Sequence: 642 a.a.     [Download]
>gi|386612398|ref|YP_006132064.1| type IV secretion protein VgrG [Escherichia coli UMNK88]
MKGVVTWFELGENDKNQKLYSMKVCPPLWRTGLRQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPHP
SREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLCI
SQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRSGSGTTLNNHFAVIPAD
RTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFGN
LAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGKE
QVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIKV
GSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKE
NTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVPK
DLPPGMPDMRQF
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|386612163|ref|NC_017641.1|:264038-265966 Escherichia coli UMNK88 chromosome, complete genome
GTGAAAGGTGTGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGAAGCTGTACAGCATGAAGG
TATGCCCGCCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGAAAG
CATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGCTGTTCAGCGAGCCACATCCT
TCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGGAAG
GCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGTGCG
TTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTAAGCACCCTCTGCATC
AGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAACGAC
CCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGTGTA
TGACTACCCCGGACGTTTCAAGGGTGCTCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGGCGC
AACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCTCCGGAGATATGGCCGGGACGGCGAATTGTGCTGA
CGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCAAGTGAACTGCACGGCGAGCAGCC
GCAGGCGGTGCCGGGACGCAGTGGTTCAGGAACCACGCTGAATAACCACTTTGCGGTAATACCGGCAGAC
CGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGGGAC
CGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGTTATAA
CCCGTCAAACCAGGACAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGATTCGGTAAC
CTGGCGATACCGCGTGTGGGTCAGGAGGTGATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGATCA
TTATGGGGCGCACCTACCACCAGGAAAACCGCACACCCGGCAGCCTGCCGGGAACAAAGACGCAGATGAC
CATTCGTTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAAGAA
CAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACTGATGTGATAA
ACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACATTGG
CGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTGGGTAGTAACCAGATTATCAAAGTG
GGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGACGG
TAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTACATAAATCACTGAT
GGTGGGAATGGGCTACAGCGTCAATGTGGGGAATAACGTCACCTTCTCGGTGGGCAAGACGATGAAGGAA
AACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGCTGG
TGCTGACGAAGGACGGAAGCATATTTCTCAACGGTACGCACATTCATCTGGAAGGGGAGTCGGATGTGAA
CGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCGAAA
GATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA