SecReT6
Protein ID: 386620383
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2854
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2913267..2913767 [+]
Producthypothetical protein
NoteTssB
UniProt IDG0DAL9
KEGG IDena:ECNA114_2854
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|386620383|ref|YP_006139963.1| hypothetical protein ECNA114_2854 [Escherichia coli NA114]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2913267-2913767 Escherichia coli NA114 chromosome, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
GCGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAGCCCGAACAGGTAGCAAAAAATATTCCACAACTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA