SecReT6
Protein ID: 386620384
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2855
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2913826..2915364 [+]
Producthypothetical protein
NoteTssC
UniProt IDG0DAM0
KEGG IDena:ECNA114_2855
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386620384|ref|YP_006139964.1| hypothetical protein ECNA114_2855 [Escherichia coli NA114]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDSWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDV
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2913826-2915364 Escherichia coli NA114 chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATCGATTCATGGCAAAA
CAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCTATCCACGTTCTGCTTTCCTGT
CTGGCGAAGTCTGGCGAGGACGTGGTTAAACTCGACAAAAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCAGTCATGCACCATCCGGAATTCCAGAAAGTCGAGTCGCTCTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAACTGCTGGATGTC
AGTAAAGAACATCTGCGGCAGGACTTTGATGATTCTCCGGAAATCATTCAAAGTGGTTTATATCGCCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGAATTCGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTCTCTGCTGCATCACATATGCCCTTT
ATCGGTTCCGTCGGACCGAAGTTCTTCCTTAAAAACTCGATGGAAGAAGTCGCCGCAATTAAAGATATCG
GCAACTATTTTGACCGCGCGGAATATATCAAATGGAAGTCGTTCCGCGATACCGACGACAGTCGCTACGT
GGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACAGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCGCAGGCGGGTGG
CGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCAGCGAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGTCGTATTAACGCCCGTTTGCCCTATATTTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAGCTTAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA