SecReT6
Protein ID: 386620386
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_28561
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2916716..2917381 [+]
Producthypothetical protein
NoteTssL
UniProt IDG0DAM2
KEGG IDena:ECNA114_28561
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386620386|ref|YP_006139966.1| hypothetical protein ECNA114_28561 [Escherichia coli NA114]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRGGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSPRQHPLLHSPFFWLVTLTLVLAGVWWGLHYWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2916716-2917381 Escherichia coli NA114 chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTCAGCCGGGAGAGCGTGGAGCACATTACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTCCTGAGCCGTGGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACTCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
GCCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCCCCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTGACGCTCACACTGGTACTGGCCGGTGTCTGGTGGGGGCTACATTACTGGCTGAACGTG
CTGGTGGATGAACTGCTGCCGCAAAGTCTGCGTTAA