SecReT6
Protein ID: 386620387
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2857
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2917394..2919046 [+]
Producthypothetical protein
NoteTagL
UniProt IDG0DAM3, G0DAM3
KEGG IDena:ECNA114_2857
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.30E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|386620387|ref|YP_006139967.1| hypothetical protein ECNA114_2857 [Escherichia coli NA114]
MRNALKQTVLLWTLLLLLTTWLGFFAVSAVVKYAVVVILVAVTAAVMAYWHKKKGQVVADDVWPSSLPPE
TYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLPVSDEEQLVAQVERLLTLRPAWASQFAVAYTVMPGMYR
DAAVLTGQLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERANSPWFICTGGEVQVATSAETTMPAQW
IAQSGAQERSQRLCYLLKAESLMQWLDLNVLAELNGPEAKCPPLAMTVGLVPSLPAVDNNLWQLWITART
GLTPDIADTGTDDALPFPDALLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDD
LHRFYAVPAEEFITKARHLSVLKDDAVMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKMD
VTASLPVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2917394-2919046 Escherichia coli NA114 chromosome, complete genome
GTGAGGAATGCGCTGAAACAGACGGTTTTGTTATGGACTCTGTTGTTGCTGCTGACTACCTGGCTGGGTT
TCTTTGCTGTATCTGCGGTCGTGAAGTATGCCGTGGTAGTGATTCTTGTCGCCGTCACAGCGGCGGTGAT
GGCGTACTGGCATAAGAAAAAGGGACAGGTCGTAGCGGACGACGTATGGCCGTCATCGCTACCGCCGGAA
ACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGATATGTCGGCGCACCTGTTCACTGACAGCCCGGTCC
GGCAGGTTTCAGAAGGGCTGTATCTGCCTGTTTCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
ACTGACCCTTCGCCCGGCGTGGGCATCGCAGTTTGCCGTGGCGTATACCGTCATGCCCGGCATGTACCGG
GATGCGGCGGTTCTGACCGGACAACTGCGCCGGTTCGCTCACAGTATGGCGACGGTGCGTCGCCGGGCGG
GCGTAAACGTACCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAGAGAGCGAATTCACC
GTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCGCAGAGACCACCATGCCCGCGCAGTGG
ATTGCACAATCCGGCGCACAGGAACGCAGTCAGCGACTCTGTTACCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGGATCTGAATGTGCTGGCGGAACTGAACGGCCCGGAGGCGAAATGTCCACCACTGGCGATGAC
CGTTGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAACC
GGCCTGACGCCGGATATCGCGGACACCGGCACAGACGATGCGCTGCCATTCCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCTGCGTGACCATGCTGGGCGTCACCACCGT
GGCGGGTATCGCCGCGCTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGAT
CTGCACCGGTTTTATGCCGTCCCGGCGGAAGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAAG
ACGATGCGGTCATGCTCGATGGGTATTACCGGGAAGGAGAACCACTACGTCTCGGTCTGGGGTTATACCC
CGGTGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAGCAAAAAATGGAC
GTGACGGCTTCGCTTCCGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGATGCGCTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGATGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA