SecReT6
Protein ID: 386620391
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2861
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2922434..2925367 [+]
Producthypothetical protein
NoteTssI
UniProt IDG0DAM7
KEGG IDena:ECNA114_2861
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-74, Aligned region: 30..167
Phage_GPD [PF05954], Evalue: 3.90E-74, Aligned region: 176..296
Phage_GPD [PF05954], Evalue: 3.90E-74, Aligned region: 299..442
Phage_GPD [PF05954], Evalue: 3.90E-74, Aligned region: 445..489
DUF2345 [PF10106], Evalue: 9.70E-46, Aligned region: 683..720
DUF2345 [PF10106], Evalue: 9.70E-46, Aligned region: 745..885
T6SS_Vgr [PF13296], Evalue: 1.40E-33, Aligned region: 622..726
Phage_base_V [PF04717], Evalue: 4.70E-14, Aligned region: 534..615
Protein Sequence: 977 a.a.     [Download]
>gi|386620391|ref|YP_006139971.1| hypothetical protein ECNA114_2861 [Escherichia coli NA114]
MNVQFFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAIAPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITSFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNLTVPQIVEKILRERHQMR
GQDFVFNLKNEYPAREQVMQYGEDDLTLHQMRGQDFVFNLKSAYPSREQVMQYGEDDLTFVSRLLSEVGI
WFRFATDARLKIEVVEFYDDQSGYERGLTLPLRHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTA
TAEMMTEQHDATGGDNTTYGERGLTLPLRHPSGLFDGETEAVWGLNSAYSVVEKSVSTRDYNYREATAEM
TTGQHDATGGDNTTYGEAYHYADNFLQKGDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEI
RVQGDDAPAVFRKGVLITGVTALNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTASAAR
DRSYELTFTAIPYSERYGYRPALIPCPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGY
ESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPAN
NKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDLWGTVRAKKGIFISSDAQDKAQ
GKVREMAPAMAILDGAQSQMKSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIASGE
HLQLAASKNLIANAGNHADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKSIE
ITSTEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDF
NQSFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDEIN
 
Nucleotide Sequence: 2934 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2922434-2925367 Escherichia coli NA114 chromosome, complete genome
ATGAACGTACAGTTCTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGTACCGA
TAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCCGTGCAG
GGAATGCCGGTGCAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCAGCTTTAAACACCTCTCCTCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAATCTGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGCCATCAAATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAACGAATACCCGGCCCGTGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTGCACCAGATGCGCGGTCAGGACTTCGTGTTTAACCTCAAAAGCGCATACCCGTCCCG
CGAACAGGTGATGCAGTACGGTGAGGACGACCTGACGTTTGTCTCACGCCTGCTGTCGGAAGTGGGTATC
TGGTTCCGCTTTGCCACCGACGCCCGGCTGAAAATCGAAGTTGTCGAGTTTTATGACGACCAGAGCGGCT
ACGAGCGCGGGCTGACACTGCCGCTTCGCCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCGGTATG
GGGGCTGAATACCGCGTACAGCGTGGTGGAAAAAAGCGTCACCACTCGGGACTACAACTACCGCACCGCC
ACAGCAGAGATGATGACAGAGCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGTGAGCGCGGAC
TGACGCTGCCGCTTCGTCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGTTGAACAG
CGCGTACAGCGTGGTGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATG
ACCACAGGCCAGCATGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCCGACA
ACTTCCTGCAAAAAGGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGCCACGAACG
CTATTTGAATGAACAGGCCATTCTACAGGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATC
AGGGTTCAGGGCGACGACGCGCCAGCAGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCCTGA
ATGAACAGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGTTCA
GGGTGACGACGCGCCAGCGGTGTTCCGCAAGGGCGTACTGATTACCGGCGTGACGGCCAGCGCGGCGCGT
GACCGCAGCTATGAACTGACGTTTACCGCCATCCCGTACTCAGAACGCTATGGCTACCGCCCGGCGCTTA
TCCCCTGCCCCGTGATGGCCGGCACGCTCCCGGCACGGGTCACCAGCACGGTGAAGAACGACATCTACGC
CCATATCGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTAT
GAAAGCCTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGG
CGGGAACGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACA
CGACTCGGCACACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTACTGCGCACCCCGGCGAAC
AACAAAATCCGCCTCGATGACGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTATGGCGGCAAGA
GCCAGCTCAACCTCGGCCATCTGGTGGATGCCGGAAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTAC
CGATCTGTGGGGTACAGTACGGGCAAAGAAAGGCATCTTTATCAGCTCCGACGCGCAGGACAAGGCGCAG
GGTAAGGTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGAAGTCGCTGT
CCACTGATGCGCAGACGGCGAATGCCGATCCGGCAGATCTGTCATCACAGATAGCGCTGTTGCAGCAGAG
TGTAAAAGATCTGACGCAGGCTGCGATCCTGCTAAGCGCACCCAAAGGCGTGGCGATCGCCAGCGGAGAG
CACCTGCAACTGGCGGCGTCGAAAAACCTGATCGCGAACGCAGGAAATCACGCTGATATCGGTGTCGTGA
AGAATATGTTTATCGGCGTGGGTCAGGCGCTGAGCGTGTTTGTACGCAAAGCGGGTATCAAACTGTTTGC
CAATAAAGGGGCGATCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCGCAGAAATCGATAGAG
ATCACCAGTACGGAAGATGAGATTAAAATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCT
ACATCCGGCTGGATGCCTGTGGGATAGAGGCCGGTACGCCGGGAGAATATAACGTTAAGGCGGGATATTA
CGGGCGTAAGCCGAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTT
AATCAGAGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAAC
TGGAAAGTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAA
GGAGGAGGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGAAATTAATTAA

Protein ID: 386620392
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2862
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2925389..2927005 [+]
Producthypothetical protein
NoteTssI
UniProt IDG0DAM8
KEGG IDena:ECNA114_2862
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 6.50E-45, Aligned region: 354..491
T6SS_Vgr [PF13296], Evalue: 1.10E-33, Aligned region: 228..333
Phage_base_V [PF04717], Evalue: 2.20E-14, Aligned region: 133..221
Protein Sequence: 538 a.a.     [Download]
>gi|386620392|ref|YP_006139972.1| hypothetical protein ECNA114_2862 [Escherichia coli NA114]
MADKSEKKKETTNKSAKKTLTKKSEKLTPAKDTAPKQVNVDPAIRLKQIRQLVRNNNKSIMGEDYIICQI
YKESRFKQFAGKNKHNAKGLMQMQRNAVRQVLTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKND
IYAHIDKDGRYRVNLDFDRDTWKPGYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAG
VKHDSAHTDHVTIQNYKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFE
LRTDLWGAVRAKKGIFISADAQDKAQGQVREMADIISELNSLSDKIQKLSDDAATANADPADMAAQIALI
TSRINDLTASVILMHAPKGVAVASGEHLQLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIR
LIANKGAVSVQAQHDLMELLAKKSIEIVSTEDEIKITAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKA
VHYGRQPKASEKVPMPEFPILSAVDSSDFCLECLLNAIKNDDAVVEGV
 
Nucleotide Sequence: 1617 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2925389-2927005 Escherichia coli NA114 chromosome, complete genome
ATGGCAGATAAATCCGAAAAGAAAAAAGAAACCACAAATAAATCAGCAAAAAAAACACTAACGAAGAAGA
GCGAAAAATTAACTCCAGCAAAAGACACCGCACCAAAACAAGTGAATGTAGATCCAGCTATAAGATTGAA
ACAAATTCGTCAACTTGTCCGTAATAATAATAAATCCATCATGGGAGAGGATTATATTATTTGTCAAATC
TATAAAGAATCTAGATTTAAGCAATTTGCAGGTAAGAATAAACATAATGCGAAAGGCTTAATGCAAATGC
AACGAAATGCAGTGAGGCAGGTGCTGACGTTTACCGCCATCCCGTACTCAGAGCGCTACGGCTACCGCCC
GGCGCTTATCCCCCGCCCGGTAATGGCCGGCACACTCCCGGCGCGGGTCACCAGCACGGTGAAAAACGAT
ATCTATGCCCATATCGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAAC
CGGGTTATGAAAGCCTGTGGGTGCGCCAGTCGCGCCCGTATGCAGGTGACACGTATGGCCTGCATCTGCC
GCTGCTGGCGGGAACGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCCGGG
GTAAAACACGACTCGGCACACACTGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTACGCACCC
CGGCGAACAACAAAATCCGCCTCGACGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGG
CGGCAAGAGCCAGCTCAACCTCGGTCATCTGGTGGATGCCGGGAAACAGCAGCGCGGGGAAGGTTTTGAA
CTGCGTACCGATCTGTGGGGTGCAGTACGGGCAAAGAAAGGCATCTTTATCAGCGCCGACGCGCAGGACA
AGGCGCAGGGTCAGGTGCGCGAAATGGCCGACATTATCAGCGAACTGAACAGCCTGAGCGATAAAATCCA
GAAACTGTCTGACGATGCGGCCACGGCGAACGCCGATCCGGCGGATATGGCCGCGCAGATAGCATTGATA
ACCAGCCGGATAAATGACCTGACCGCCTCGGTGATTTTGATGCACGCACCGAAAGGCGTGGCGGTCGCCA
GCGGCGAGCACCTGCAACTGGCCGCGGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGG
CGTAGTGAAGAATATGTTTATCGGCGTGGGACGGGCGCTGAGCGTGTTTGTACGCAAGGCGGGTATCAGG
CTGATTGCCAATAAAGGCGCAGTATCGGTACAGGCGCAGCACGATCTGATGGAGTTACTGGCGAAAAAAT
CGATAGAGATCGTCAGTACCGAAGATGAGATTAAAATCACCGCGAAGAAAAAAATAACGATTAATGGTGG
TGGGAGTTATATCCGGATAGAGGGTAGCGGCATTGAGCCGGGAACGCCGGGGGATTATAACGTCAAAGCG
GTACATTACGGGCGTCAGCCTAAAGCCTCGGAGAAGGTTCCTATGCCAGAATTTCCCATCCTTTCAGCCG
TGGACTCATCCGATTTTTGTCTTGAATGCCTGCTGAATGCCATCAAAAACGATGACGCTGTTGTTGAAGG
AGTGTAA

Protein ID: 386620395
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2865
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2930371..2930643 [+]
Producthypothetical protein
NoteTssI
UniProt IDG0DAN1
KEGG IDena:ECNA114_2865
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 90 a.a.     [Download]
>gi|386620395|ref|YP_006139975.1| hypothetical protein ECNA114_2865 [Escherichia coli NA114]
MDIPTLNFDHSHHKLKIRGLKSPADVLTFTGHEQLSSPFRYDIEFTSTNKAITPESVLMQDGAFSWKKQY
FNYHPKPNGCWDMEREIYYL
 
Nucleotide Sequence: 273 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2930371-2930643 Escherichia coli NA114 chromosome, complete genome
ATGGATATCCCGACTCTGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGG
CGGATGTGCTGACGTTTACGGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTGAGTTTACCAG
TACCAATAAAGCAATAACGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCTGGAAAAAACAATAT
TTTAATTATCATCCGAAACCAAATGGATGTTGGGACATGGAAAGGGAAATATATTATCTATGA