SecReT6
Protein ID: 386620395
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2865
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2930371..2930643 [+]
Producthypothetical protein
NoteTssI
UniProt IDG0DAN1
KEGG IDena:ECNA114_2865
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 90 a.a.     [Download]
>gi|386620395|ref|YP_006139975.1| hypothetical protein ECNA114_2865 [Escherichia coli NA114]
MDIPTLNFDHSHHKLKIRGLKSPADVLTFTGHEQLSSPFRYDIEFTSTNKAITPESVLMQDGAFSWKKQY
FNYHPKPNGCWDMEREIYYL
 
Nucleotide Sequence: 273 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2930371-2930643 Escherichia coli NA114 chromosome, complete genome
ATGGATATCCCGACTCTGAATTTCGACCACTCACACCACAAGCTCAAAATTCGCGGCCTGAAAAGCCCGG
CGGATGTGCTGACGTTTACGGGCCACGAACAGCTCAGCTCACCCTTCCGCTACGACATTGAGTTTACCAG
TACCAATAAAGCAATAACGCCGGAGTCGGTGCTGATGCAGGACGGCGCATTCAGCTGGAAAAAACAATAT
TTTAATTATCATCCGAAACCAAATGGATGTTGGGACATGGAAAGGGAAATATATTATCTATGA