SecReT6
Protein ID: 386620398
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2868
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2935456..2937081 [+]
Producthypothetical protein
NoteTssA
UniProt IDG0DAN4
KEGG IDena:ECNA114_2868
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-20, Aligned region: 72..131
Protein Sequence: 541 a.a.     [Download]
>gi|386620398|ref|YP_006139978.1| hypothetical protein ECNA114_2868 [Escherichia coli NA114]
MGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLVPVTADTPVGEDPGYHDDFLRIRDEMNKLSGA
DTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALE
WLAGEKMLDSLARYPEVAKEDFANIVAALNQLSVSFTAWPEDQHSPSLMPLINALESRLAQSGGMNAVVP
QNSSGVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGK
TRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAVIRQD
LALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMA
DSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFE
VKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1626 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2935456-2937081 Escherichia coli NA114 chromosome, complete genome
ATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCAC
TGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGGTGCCGGTGACGGCAGACACGCCGGT
CGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATCCGCGACGAAATGAACAAACTGTCCGGTGCC
GATACCGGCCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACGTGCGCATCGCCA
CTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAAGGACTGGCGCTGTTAGC
CGGGCTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCAAGCCGAAAAATGGCGCTGGAG
TGGCTGGCGGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAGGTGGCAAAAGAGGATTTTGCGA
ACATTGTTGCCGCTCTTAATCAACTGTCGGTTTCCTTCACTGCATGGCCCGAAGACCAGCATTCCCCCTC
CCTGATGCCGCTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAACGCGGTGGTGCCG
CAAAACAGCAGCGGCGTTCCGGCACCGTCTTCCCCGGTGGATGCGCCGCAGGTACAGACCATCACCTCCG
GGCGCGACCTACTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTC
AGCACACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGACGTGGACGGCAAA
ACCCGGCTGGCCCCGCCGCGCACCGAATCACGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGA
CGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGTGTCAGCCATTTCTGGCTGGATATCCAGTG
GTATCTGCATCAGGCGCTGGCGAAGGCGGGCGCACCGTGGGACAGATGGACAGCGGTTATCCGTCAGGAC
CTGGCGCTGCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCACGCCGTTTGCCG
ATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAA
AGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGAGATGGCT
GACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGC
GCCTGTTATTGCGACTGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCT
GCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACACAGTGGGAGCCAGAGCTGCTGTTTGAA
GTAAAAGCCCGACAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACC
GAAAAATGGAAATCCTGCTGGGAACGCTGGTGGCAATCGATCCGGTACGGGCAGCGGTATTGTGTGATAC
GCAACATAAGGACTGA