SecReT6
Protein ID: 386620399
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2869
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2937087..2938289 [+]
Producthypothetical protein
NotePAAR
UniProt IDG0DAN5
KEGG IDena:ECNA114_2869
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.30E-11, Aligned region: 9..66
Protein Sequence: 400 a.a.     [Download]
>gi|386620399|ref|YP_006139979.1| hypothetical protein ECNA114_2869 [Escherichia coli NA114]
MGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGTLD
SQSSCPCKARFIASMMDDTYETDDGESEAEQHAQSAKKDLTSGSDSSSDDVKLDYRIKLSGNKILTPLNI
PDYKEMINGGSTKNTEKIDFTITNKGDEAEGLSLEVLDGNEVIYSERQTGKYFTKGEHAWQWDGYSNQGI
LDTTKLKSKSLLVRLIALCGDMMIKVDYPLKTSANEEDWVDIEVNKNNKTVNIIWRLAVSDGGIKGSNPK
LSPVPYNDLVDLTKNGVEFYWSRNGSRGGGIGESIVTAIGVFKVNVKAEINITPSMRTFSLISSLDPDFQ
ASVSLSGFEKIYYNYGDSYKDIQDELQALLDANKNFIWISYILFIEEILI
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2937087-2938289 Escherichia coli NA114 chromosome, complete genome
ATGGGAACAGGCTACTTTCTGGTCAGGGGGGATAAGACCACCTGTGGTGGAAAAATTATTGAAGGGGCGG
ACGACCATACGATCATGGGTATCCCGCAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATATCCGGG
AATGTTTATTATTGTGGGCGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACGCTGGAC
AGTCAGAGCAGTTGCCCGTGTAAAGCACGGTTTATTGCGTCAATGATGGATGATACGTATGAGACGGATG
ACGGGGAAAGTGAAGCGGAACAACATGCGCAGTCGGCGAAAAAGGATCTGACTTCTGGTTCTGATTCATC
CTCTGATGATGTAAAACTGGATTACAGAATTAAATTATCAGGTAATAAGATACTGACGCCACTGAATATA
CCTGATTATAAAGAAATGATAAACGGTGGTAGCACGAAGAATACAGAAAAAATAGATTTTACCATCACAA
ATAAAGGCGATGAGGCTGAAGGACTTTCCCTGGAAGTGCTTGATGGCAATGAAGTGATTTATAGTGAACG
GCAGACCGGTAAATATTTTACTAAGGGAGAGCATGCCTGGCAATGGGATGGCTACAGTAATCAAGGCATA
CTGGATACAACTAAGCTAAAAAGTAAATCACTACTCGTAAGACTGATTGCTTTATGTGGTGATATGATGA
TAAAAGTTGATTATCCATTGAAAACTTCTGCGAATGAGGAAGATTGGGTAGATATAGAAGTTAACAAAAA
CAATAAGACAGTAAATATAATATGGCGACTGGCAGTTAGTGATGGAGGGATAAAAGGAAGTAATCCTAAG
TTATCCCCAGTTCCTTATAACGACTTGGTTGACCTGACCAAAAATGGAGTTGAATTTTATTGGTCTCGAA
ATGGAAGTCGCGGCGGGGGGATTGGTGAAAGTATTGTTACAGCGATTGGTGTTTTTAAAGTAAATGTAAA
GGCTGAGATAAATATTACTCCATCCATGCGAACTTTTTCTTTGATATCATCATTAGATCCTGACTTTCAG
GCATCCGTTAGTCTATCAGGATTTGAAAAAATATATTATAACTACGGTGATAGTTATAAGGATATTCAAG
ATGAATTACAGGCACTTCTTGACGCTAATAAAAACTTTATCTGGATATCATATATCCTCTTTATTGAAGA
AATCCTCATCTAG