SecReT6
Protein ID: 386620401
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_28701
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2940141..2941220 [+]
Producthypothetical protein
NoteTssG
UniProt IDG0DAN7
KEGG IDena:ECNA114_28701
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|386620401|ref|YP_006139981.1| hypothetical protein ECNA114_28701 [Escherichia coli NA114]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQRQQNAPLGSTDSPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSPISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2940141-2941220 Escherichia coli NA114 chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGCGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCC
CGCCGCCGATGCGGTGCGCTTTCGTCCTCATCCGGGGATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACAGTGCGCACCACTTTTCTCGGCCTGTACGGCGTGG
ATTCGCCACTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCGGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCAGTGGATGACATTTCCCGTTGCCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTTACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCATGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACCCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGACTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA