SecReT6
Protein ID: 386620403
SecReT6 ID632
T6SS typei2
Gene symbol-
Locus tagECNA114_2872
StrainEscherichia coli NA114
Repliconchromosome [GenBank: NC_017644] [Browse all T6SS(s) in this replicon]
Location [Strand]2941741..2942169 [+]
Producthypothetical protein
NoteTssE
UniProt IDG0DAN9
KEGG IDena:ECNA114_2872
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-17, Aligned region: 26..114
Protein Sequence: 142 a.a.     [Download]
>gi|386620403|ref|YP_006139983.1| hypothetical protein ECNA114_2872 [Escherichia coli NA114]
MSTPSLYEMLTFSFSGELPLEQVRERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386617516|ref|NC_017644.1|:2941741-2942169 Escherichia coli NA114 chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGGTCA
GAGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAACAGGAGCGG
GCGTACTGA