SecReT6
Protein ID: 386630554
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3107
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3111538..3112059 [+]
Producthypothetical protein
NoteTssB
UniProt IDG7R6P3
KEGG IDeld:i02_3107
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-52, Aligned region: 13..165
Protein Sequence: 173 a.a.     [Download]
>gi|386630554|ref|YP_006150274.1| hypothetical protein i02_3107 [Escherichia coli str. 'clone D i2']
MDDEEKDMADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNF
NSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDN
ATFRRELENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3111538-3112059 Escherichia coli str. 'clone D i2' chromosome, complete genome
GTGGATGATGAGGAAAAGGATATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCA
AGCTTGATCTGCATACAGGCAATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGA
TTACAGTAACGGAAAAGAGCAACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTC
AACAGCGTCATGGCTGAGTTTTCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTA
ATGAACAAAATATCGCGCTTGAATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATAT
TCCGCAACTTCGTGTATTACTCGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAAC
GCAACGTTTCGCCGTGAACTGGAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAAC
TGGCGAAAATTGCGCCGCAGGAGAACGTTTAA