SecReT6
Protein ID: 386630555
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3108
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3112112..3113656 [+]
Producthypothetical protein
NoteTssC
UniProt IDG7R6P4
KEGG IDeld:i02_3108
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-173, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|386630555|ref|YP_006150275.1| hypothetical protein i02_3108 [Escherichia coli str. 'clone D i2']
MLMSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLL
SCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELL
DISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHM
PFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFA
VPHFQIEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3112112-3113656 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGCTGATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCG
GCGTTTATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATCGATTTATG
GCAAAACAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCGATTCACGTTCTGCTT
TCCTGTCTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACG
ATCTGGATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTC
GCTGTGGCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTG
GATATCAGCAAAGAGCATCTGCGTCAGGATTTTGATGATTCACCGGAAATCATTCAGAGTGGTTTATATC
GCCATACATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGA
ATTTGATAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTGTCTGCCGCTTCCCATATG
CCTTTTATCGGTTCTGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCG
CTATGTGGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGC
AGCTTTAACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTGTGGACAAACGCCTCGTTCG
CCTTTGCCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGCCCACAGGC
GGGCGGCGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCG
TCCGAAGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAACCTTGGCTTTATTCCACTCTCTTATT
ACAAAAACCGCGATTACGCCTGCTTTTTCTCGGCAAACTCCGCCCAGAAACCGGCGCTGTATGATACCGC
TGACGCCACCGCCAACAGCCGTATCAACGCCCGTTTGCCCTATATCTTCCTGCTGTCCCGCATTGCTCAC
TACCTGAAAATTATTCAGCGCGAGAATATCGGCACCACCAAAGACCGCCGCGTGCTGGAACTGGAGCTTA
ACACCTGGATCCGCACGCTGGTGACGGAAATGACCGATCCGGGCGATGAACTTCAGGCTTCGCATCCACT
GCGCGACGGGAAAGTTATCGTCGAGGACATAGAGGACAATCCGGGCTTTTTCCGCGTCAGACTCTTTGCC
GTGCCGCATTTCCAGATCGAAGGGATGGACGTCAACCTTTCTCTGGTTTCCCAGATGCCAAAAGCAAAAG
CCTGA