SecReT6
Protein ID: 386630556
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3109
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3113676..3115013 [+]
Producthypothetical protein
NoteTssK
UniProt IDG7R6P5
KEGG IDeld:i02_3109
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.70E-132, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|386630556|ref|YP_006150276.1| hypothetical protein i02_3109 [Escherichia coli str. 'clone D i2']
MKICRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALALGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSIVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVPLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3113676-3115013 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGAAAATTTGTCGACCACTGTGGGCTGAGGGGACATTCCTGTCTTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGGCGCTCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGTACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTCCTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAACTCCGCCGAGCCGGTACTGAGTGATTTCCTGCGCTACCCGGC
GGTTCATCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAA
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCATCGTCTTTCCGCCACTTTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGACTTTTACCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAATGTGGCGCTGAATGGTGTTCCACTGGTGCCGCTTACCTCAGTTCCGGCAGCGCT
GCCACTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCGGGAACAATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA