SecReT6
Protein ID: 386630557
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3110
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3115010..3115675 [+]
Producthypothetical protein
NoteTssL
UniProt IDG7R6P6
KEGG IDeld:i02_3110
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386630557|ref|YP_006150277.1| hypothetical protein i02_3110 [Escherichia coli str. 'clone D i2']
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQTIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3115010-3115675 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTCCTGAGCCGTAGCGGCATGGACGACGGTCAGACCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCATT
TTTCTGGCTGGTAACACTGGCGCTGCTACTGGCGGGCGTCTGGTGGGGGCTACACCACTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA