SecReT6
Protein ID: 386630559
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3112
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3117398..3117889 [+]
Productsecreted protein Hcp
NoteTssD
UniProt IDG7R6P8
KEGG IDeld:i02_3112
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386630559|ref|YP_006150279.1| secreted protein Hcp [Escherichia coli str. 'clone D i2']
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKDPSREKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3117398-3117889 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCAGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTTGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
TATGCACGACATCAAGGATCCTTCCAGAGAGAAGCATAACCACCTGGAACGTATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA