SecReT6
Protein ID: 386630567
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3120
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3131029..3132666 [+]
Producthypothetical protein
NoteTssA
UniProt IDG7R6Q6
KEGG IDeld:i02_3120
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 75..135
ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 164..189
Protein Sequence: 545 a.a.     [Download]
>gi|386630567|ref|YP_006150287.1| hypothetical protein i02_3120 [Escherichia coli str. 'clone D i2']
MWKSMGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNLLTVSFAAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSGVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LAMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRHADKAALARKMDALLGSLVAIDPARTAVLCDTQHKD
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3131029-3132666 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGTGGAAGAGTATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTTCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGCCCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCGGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCCCTGAATCTGCTGACGGTTTCCTTCGCCGCGTGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCACAGTCGGGCGGAATGAAC
GCGGTGGTGCCGCAGAACAGCAGCGGCGTTCCGGCACCGTCATCCCCGGTGGATGCGCCGCAGGTACAGA
CCATCACCTCCGGACGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGAC
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGTCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCCGTT
ATCCGTCAGGACCTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGCGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGGCTGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAA
CTGCTGTTTGAAGTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCACATCGCCACGCGGACAAGG
CGGCGCTTGCCCGGAAAATGGACGCTCTGCTGGGTTCGCTGGTGGCAATCGATCCGGCGCGGACAGCGGT
ACTGTGTGATACGCAGCATAAGGACTGA