SecReT6
Protein ID: 386630568
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3121
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3132700..3134460 [+]
Producthypothetical protein
NoteTssF
UniProt IDG7R6Q7
KEGG IDeld:i02_3121
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386630568|ref|YP_006150288.1| hypothetical protein i02_3121 [Escherichia coli str. 'clone D i2']
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLKEFQVLSRPIGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQER
RVLDAHFSPMGFDDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLAE
NWPHDLPFNTDNLRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3132700-3134460 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTTG
CGCAGGCTTACCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGACCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAAAGAGTTTCAGGTGCTATCCCGTCC
CATCGGCGAACGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGAACGC
CGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAAGGTGAGT
CAGCGTTCAGCGGCTACCAGTTGTTGCTGGAATATTTCACCTTCCGTGAGAAGTTTATGTTTGTGGCGCT
GAACGGGCTGGAGAACGTCATCTGGCCGGAAAGGATAACCGGCTTTGAGATTGACGTGGTGCTGGCGGAA
AACTGGCCTCATGATTTGCCGTTTAATACCGACAATCTCCGCCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCGCTGGAAAACGAATTTCTGCTGCGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATGCATTTGA
TACTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCAGCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCTCCGACGCAGCCCTGCTATCCCCCTGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGTCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCACTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA