SecReT6
Protein ID: 386630569
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3122
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3134424..3135503 [+]
Producthypothetical protein
NoteTssG
UniProt IDG7R6Q8
KEGG IDeld:i02_3122
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|386630569|ref|YP_006150289.1| hypothetical protein i02_3122 [Escherichia coli str. 'clone D i2']
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDSPATDAVRFRPHPGMGFPVSELKNV
ERDAGNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDANSQLLLKLYTEDAAEARGWLPDGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3134424-3135503 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCC
CGCCACCGATGCGGTGCGCTTTCGTCCTCATCCCGGTATGGGCTTTCCGGTCAGCGAGTTAAAAAACGTT
GAACGTGACGCGGGCAATCCCGACGCGCCCCCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCCACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATTACTCAGTACTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTAGGGCTGCTTGCCCCGCTGACCAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGCCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGACGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA