SecReT6
Protein ID: 386630571
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3124
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3136024..3136452 [+]
Producthypothetical protein
NoteTssE
UniProt IDG7R6R0
KEGG IDeld:i02_3124
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-17, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|386630571|ref|YP_006150291.1| hypothetical protein i02_3124 [Escherichia coli str. 'clone D i2']
MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3136024-3136452 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGATCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACACTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AATTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAACAGGAGCGG
GCGTACTGA