SecReT6
Protein ID: 386630572
SecReT6 ID633
T6SS typei2
Gene symbol-
Locus tagi02_3125
StrainEscherichia coli str. 'clone D i2'
Repliconchromosome [GenBank: NC_017651] [Browse all T6SS(s) in this replicon]
Location [Strand]3136452..3137828 [+]
Producthypothetical protein
NoteTssA
UniProt IDG7R6R1
KEGG IDeld:i02_3125
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 118..127
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 1.10E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|386630572|ref|YP_006150292.1| hypothetical protein i02_3125 [Escherichia coli str. 'clone D i2']
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLCLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDLLAGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPLSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|386627502|ref|NC_017651.1|:3136452-3137828 Escherichia coli str. 'clone D i2' chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCGGATGTGGACTGGCGTCAGGTGGA
AAAACTCTGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATCTACTGGCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCTGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA