SecReT6
Protein ID: 386635474
SecReT6 ID634
T6SS typei2
Gene symbol-
Locus tagi14_3107
StrainEscherichia coli str. 'clone D i14'
Repliconchromosome [GenBank: NC_017652] [Browse all T6SS(s) in this replicon]
Location [Strand]3111538..3112059 [+]
Producthypothetical protein
NoteTssB
UniProt IDG7RTJ5
KEGG IDelc:i14_3107
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-52, Aligned region: 13..165
Protein Sequence: 173 a.a.     [Download]
>gi|386635474|ref|YP_006155193.1| hypothetical protein i14_3107 [Escherichia coli str. 'clone D i14']
MDDEEKDMADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNF
NSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDN
ATFRRELENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|386632422|ref|NC_017652.1|:3111538-3112059 Escherichia coli str. 'clone D i14' chromosome, complete genome
GTGGATGATGAGGAAAAGGATATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCA
AGCTTGATCTGCATACAGGCAATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGA
TTACAGTAACGGAAAAGAGCAACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTC
AACAGCGTCATGGCTGAGTTTTCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTA
ATGAACAAAATATCGCGCTTGAATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATAT
TCCGCAACTTCGTGTATTACTCGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAAC
GCAACGTTTCGCCGTGAACTGGAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAAC
TGGCGAAAATTGCGCCGCAGGAGAACGTTTAA