SecReT6
Protein ID: 386640295
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c30890
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3145639..3147177 [+]
Producthypothetical protein
NoteTssC
UniProt IDE1P9P6
KEGG IDeab:ECABU_c30890
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.30E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386640295|ref|YP_006107093.1| hypothetical protein ECABU_c30890 [Escherichia coli ABU 83972]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3145639-3147177 Escherichia coli ABU 83972 chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATCGATTTATGGCAAAA
CAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCGATTCACGTTCTGCTTTCCTGT
CTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTTGATGATTCACCGGAAATCATTCAGAGTGGTTTATATCGCCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTAGCCTCATTAATATCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTGTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGCCCACAGGCGGGCGG
CGCAGTGGCCGATCTGCCGATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAACCTTGGCTTTATTCCACTCTCTTATTACAAAA
ACCGCGATTACGCCTGCTTTTTCTCGGCAAACTCCGCCCAGAAACCGGCGCTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATCAACGCCCGTTTGCCCTATATCTTCCTGCTGTCCCGCATTGCTCACTACCTG
AAAATTATTCAGCGCGAGAATATCGGCACCACCAAAGACCGCCGCGTGCTGGAACTGGAGCTTAACACCT
GGATCCGCACGCTGGTGACGGAAATGACCGATCCGGGCGATGAACTTCAGGCTTCGCATCCACTGCGCGA
CGGGAAAGTTATCGTCGAGGACATAGAGGACAATCCGGGCTTTTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATCGAAGGGATGGACGTCAACCTTTCTCTGGTTTCCCAGATGCCAAAAGCAAAAGCCTGA