SecReT6
Protein ID: 386640297
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c30910
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3148531..3149196 [+]
Producthypothetical protein
NoteTssL
UniProt IDE1P9P8
KEGG IDeab:ECABU_c30910
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386640297|ref|YP_006107095.1| hypothetical protein ECABU_c30910 [Escherichia coli ABU 83972]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQTIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3148531-3149196 Escherichia coli ABU 83972 chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTCCTGAGCCGTAGCGGCATGGACGACGGTCAGACCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCATT
TTTCTGGCTGGTAACACTGGCGCTGCTACTGGCGGGCGTCTGGTGGGGGCTACACCACTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA