SecReT6
Protein ID: 386640301
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c30960
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3154250..3156712 [+]
ProductVGR-related protein
NoteTssI
UniProt IDE1P9Q2
KEGG IDeab:ECABU_c30960
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-63, Aligned region: 30..347
Phage_GPD [PF05954], Evalue: 3.90E-63, Aligned region: 586..613
DUF2345 [PF10106], Evalue: 5.00E-39, Aligned region: 573..592
DUF2345 [PF10106], Evalue: 5.00E-39, Aligned region: 598..749
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 480..585
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 585..610
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 820 a.a.     [Download]
>gi|386640301|ref|YP_006107099.1| VGR-related protein [Escherichia coli ABU 83972]
MNVQFFDHAHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAIAPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFLQQ
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTTSAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKEQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQGQ
VLEMQPALARLSAALVTMESLAASAQQAQALAADVSRQQTLLQQKIEQLQQEVLLGSAPKGVALVSGEDM
QLSASDNLTLTAGKQLDIGVQKDFTLAAGKQLSLYSRAGAKLFSSHNDIDIQAQGGNLTTWSTQDTYISS
GKKLVVTAQDELTLICGGGYIKIKSGNVEIGGPGKLLVKNAGIKKAGSGSMQGVMKSFEPESFDENFIIS
NPASGKPIANQKYEIHMPDGSVIAGITDAMGYSSLVASKASDDLKIILKK
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3154250-3156712 Escherichia coli ABU 83972 chromosome, complete genome
ATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGCAGCGA
TAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGATGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTGTTTCACGCCTGCTGTCAGAGGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GTTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTACGAGCGCGGGCTGACGCTGCCGCTT
CGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCGCGTACAGCGTGG
TGGAAAAAAGTGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGACCACAGGCCAGCA
TGACGCCACCGGGGGCGATAACACCACTTACGGCGAAGCCTACCACTATGCCGACAACTTCCTGCAACAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGTCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGTTCAGGGCGA
CGACGCGCCTGCGGTGTTCCGCAAGGGCGTGCTGATTACCGGCGTGACGACCAGCGCGGCGCGTGACCGC
AGCTATGAGCTGACGTTCACGGCGATACCGTACTCAGAACGCTACGGCTACCGTCCGGCGCTAATCCCCC
GCCCGGTCATGGCCGGAACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATCTATGCCCATAT
CGACAAGGACGGGCGCTACCGAGTCAACCTTGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACAGGCCGTATATCGCCGGGGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCCAACAACAAA
ATCCGGCTGGATGACGAGCGCGGGAAGGAGCATATCAAGGTCAGTACCGAATATGGCGGCAAGAGCCAGC
TAAACCTCGGCCATCTTGTTGATGCCGGGAAAGAACAGCGTGGCGAAGGCTTTGAACTGCGTACCGATCT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCTGATGCGCAGGATAAGGCGCAGGGTCAG
GTGCTGGAGATGCAGCCAGCTCTGGCTCGCCTTTCTGCAGCGTTGGTGACAATGGAATCTCTGGCTGCCA
GTGCGCAACAGGCTCAGGCACTGGCGGCAGATGTGAGTCGTCAGCAGACGCTGTTGCAGCAAAAAATTGA
GCAGTTACAGCAGGAAGTGCTACTGGGTAGCGCACCTAAGGGCGTGGCGCTTGTCAGCGGTGAGGATATG
CAGTTGTCTGCCAGCGATAATCTGACTCTGACAGCAGGTAAGCAACTGGATATTGGCGTACAGAAAGACT
TTACGCTGGCAGCAGGAAAACAGCTCAGCTTGTATAGCCGTGCGGGAGCAAAGCTCTTTAGCTCACATAA
CGATATTGATATTCAGGCGCAGGGGGGAAATCTGACCACCTGGTCAACACAGGACACCTATATATCGAGT
GGTAAAAAGCTGGTGGTGACAGCGCAGGATGAGTTAACACTGATTTGTGGCGGGGGCTATATCAAAATTA
AAAGTGGCAATGTGGAGATTGGCGGTCCGGGAAAACTATTGGTTAAAAATGCCGGTATTAAGAAAGCAGG
CTCCGGTAGTATGCAGGGCGTGATGAAGTCGTTTGAGCCTGAAAGTTTCGATGAAAATTTCATTATTTCG
AATCCAGCATCAGGTAAGCCGATAGCAAATCAAAAATATGAAATACACATGCCAGATGGGAGTGTTATTG
CCGGGATAACCGATGCAATGGGGTATTCCTCTCTTGTTGCGTCAAAAGCATCTGATGACCTAAAAATTAT
TCTGAAAAAATGA