SecReT6
Protein ID: 386640307
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31020
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3164562..3166187 [+]
ProductImpA-like protein
NoteTssA
UniProt IDE1P9Q8
KEGG IDeab:ECABU_c31020
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 71..131
ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 160..185
Protein Sequence: 541 a.a.     [Download]
>gi|386640307|ref|YP_006107105.1| ImpA-like protein [Escherichia coli ABU 83972]
MGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNKLSGA
DTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALE
WLAGEKMLDSLARYPEVAKEDFANIVAALNLLTVSFAAWPEDQHSPSLMPLINALESRLAQSGGMNAVVP
QNSSGVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGK
TRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAVIRQD
LALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALAMA
DSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFE
VKARQLKLLRLRAHRHADKAALARKMDALLGSLVAIDPARTAVLCDTQHKD
 
Nucleotide Sequence: 1626 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3164562-3166187 Escherichia coli ABU 83972 chromosome, complete genome
ATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCAC
TGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAGATACGCCGGT
CGGGGAAGACCCCGGCTACCACGACGATTTTCTGCGTATCCGCGACGAGATGAACAAACTTTCCGGCGCG
GATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACGTGCGCATCGCCA
CTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACTGGCGCTGCTGAC
CGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGCCCGGCCAGCCGGAAAATGGCGCTGGAG
TGGCTGGCGGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGA
ACATTGTTGCCGCCCTGAATCTGCTGACGGTTTCCTTCGCCGCGTGGCCCGAAGACCAGCATTCCCCCTC
CCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCACAGTCGGGCGGAATGAACGCGGTGGTGCCG
CAGAACAGCAGCGGCGTTCCGGCACCGTCATCCCCGGTGGATGCGCCGCAGGTACAGACCATCACCTCCG
GACGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTC
GGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGACGTGGACGGCAAA
ACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGA
CGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGTCATTTCTGGCTGGACATTCAGTG
GTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCCGTTATCCGTCAGGAC
CTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCACACCGTTCGCCG
ACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAA
AGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGCGATGGCA
GACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGC
GCCTGTTATTGCGGCTGCTGATGGCACGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCT
GCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAACTGCTGTTTGAA
GTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCACATCGCCACGCGGACAAGGCGGCGCTTGCCC
GGAAAATGGACGCTCTGCTGGGTTCGCTGGTGGCAATCGATCCGGCGCGGACAGCGGTACTGTGTGATAC
GCAGCATAAGGACTGA