SecReT6
Protein ID: 386640308
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31030
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3166221..3167981 [+]
Producthypothetical protein
NoteTssF
UniProt IDE1P9Q9
KEGG IDeab:ECABU_c31030
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386640308|ref|YP_006107106.1| hypothetical protein ECABU_c31030 [Escherichia coli ABU 83972]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLKEFQVLSRPIGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQER
RVLDAHFSPMGFDDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLAE
NWPHDLPFNTDNLRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3166221-3167981 Escherichia coli ABU 83972 chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTTG
CGCAGGCTTACCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAAAGAGTTTCAGGTGCTATCCCGTCC
CATCGGCGAACGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGAACGC
CGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAAGGTGAGT
CAGCGTTCAGCGGCTACCAGTTGTTGCTGGAATATTTCACCTTCCGTGAGAAGTTTATGTTTGTGGCGCT
GAACGGGCTGGAGAACGTCATCTGGCCGGAAAGGATAACCGGCTTTGAGATTGACGTGGTGCTGGCGGAA
AACTGGCCTCATGATTTGCCGTTTAATACCGACAATCTCCGCCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCGCTGGAAAACGAATTTCTGCTGCGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATGCATTTGA
TACTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCAGCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCTCCGACGCAGCCCTGCTATCCCCCTGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGTCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCACTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA