SecReT6
Protein ID: 386640309
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31040
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3168035..3169024 [+]
Producthypothetical protein
NoteTssG
UniProt IDE1P9R0
KEGG IDeab:ECABU_c31040
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-77, Aligned region: 2..289
Protein Sequence: 329 a.a.     [Download]
>gi|386640309|ref|YP_006107107.1| hypothetical protein ECABU_c31040 [Escherichia coli ABU 83972]
MLEQSQQNAPLGSTDSPATDAVRFRPHPGMGFPVSELKNVERDAGNPDAPPTVRTTFLGLYGVDSPLPTA
YLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYPASFEAGAVDDISRCLLGLIGLGIPGSENHI
ATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVVPHDPQPVILPAPAGLSKNSRISLKTRTLLG
RTGTDVNSQLLLKLYTEDAAEARGWLPDGQLHSDLLVLLRVYLGWRCQARLQLTLPVSLLPAARLGKQRV
QISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRESMTHVSYSF
 
Nucleotide Sequence: 990 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3168035-3169024 Escherichia coli ABU 83972 chromosome, complete genome
TTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAGCCCCGCCACCGATGCGGTGCGCT
TTCGTCCTCATCCCGGTATGGGCTTTCCGGTCAGCGAGTTAAAAAACGTTGAACGTGACGCGGGCAATCC
CGACGCGCCCCCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGGATTCGCCGCTGCCCACCGCC
TATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGCGTTTCTCGATATTTTTAACC
ATCGCTTTATTACTCAGTACTACCGCATCTGGCGCAAATATAACTACCCGGCGTCGTTTGAAGCAGGTGC
CGTGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTCCCGGCAGCGAGAACCATATC
GCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCCGACGCGCACGGCGGAAGGCG
TCACGGCACTGGTAGGGCTGCTTGCCCCGCTGACCAAAGCGACGGTGGTGCCTCACGATCCGCAGCCTGT
AATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGAAAACGCGAACGCTGCTGGGG
CGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGAAGATGCCGCAGAAGCACGTG
GCTGGCTGCCCGACGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGCGTTTATCTGGGCTGGCGCTG
TCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCCGGCTGGGAAAACAGCGTGTA
CAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGACCGGAACAGTGACGGTCAGTC
TGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAGAGTATGACTCATGTTTCCTA
TTCGTTTTAA