SecReT6
Protein ID: 386640310
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31050
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3169035..3169541 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE1P9R1
KEGG IDeab:ECABU_c31050
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.40E-36, Aligned region: 9..158
Protein Sequence: 168 a.a.     [Download]
>gi|386640310|ref|YP_006107108.1| hypothetical protein ECABU_c31050 [Escherichia coli ABU 83972]
MLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLSTMVHVWQLKTR
EDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPDEKSDSWRLVI
KRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 507 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3169035-3169541 Escherichia coli ABU 83972 chromosome, complete genome
TTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGTGGCTGCGGCCTGATTCAGAAAGTGGTGGATGAAT
CGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAAAATACTGCATCTCGATTTCTTCTCCCGCAG
CGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACGATGGTGCATGTCTGGCAACTGAAAACCCGC
GAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGCAGGAAGAGAAGACGCTGGAGAAGGACGTAC
TGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGCATCCCTGAATGTGCCGCTGGATAAAGAGAC
GCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGATGAAAAAAGCGACAGCTGGCGTCTGGTGATC
AAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTGAACTGATGAGAAGCGACCTGCGACTGCTGC
CTCTCAAGGATAAATAA