SecReT6
Protein ID: 386640311
SecReT6 ID624
T6SS typei2
Gene symbol-
Locus tagECABU_c31060
StrainEscherichia coli ABU 83972
Repliconchromosome [GenBank: NC_017631] [Browse all T6SS(s) in this replicon]
Location [Strand]3169545..3169973 [+]
Producthypothetical protein
NoteTssE
UniProt IDE1P9R2
KEGG IDeab:ECABU_c31060
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-17, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|386640311|ref|YP_006107109.1| hypothetical protein ECABU_c31060 [Escherichia coli ABU 83972]
MSTPSLYEMLTFSFSGELPLEQISERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMAAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386637352|ref|NC_017631.1|:3169545-3169973 Escherichia coli ABU 83972 chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCGCTGGAACAGATCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGCCGGGCAGGCAC
GCTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGGATGGCTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACACTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AATTACTCCCCCAGCCCCGTCCGGGGCATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTATTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAACAGGAGCGG
GCGTACTGA