SecReT6
Protein ID: 386698719
SecReT6 ID636
T6SS typei1
Gene symbol-
Locus tagKO11_01075
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]251550..252881 [-]
Producthypothetical protein
NoteTssK
UniProt IDE8YBR5
KEGG IDeko:EKO11_3697, ekf:KO11_01075
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|386698719|ref|YP_006162556.1| hypothetical protein KO11_01075 [Escherichia coli KO11FL]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNNLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQHFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
TRTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c252881-251550 Escherichia coli KO11FL chromosome, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGTCCACACCATTTCCAGCAGC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATAATTTATCCTGGGGATTTAC
CGAACTCACTCTCAACAATGAACTGCTGGCACAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAACATTTTC
CGGACGAGAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
ACGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGTGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGCATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCGCGCTCGTCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACGCTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCCGTTAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCTGTGGCGGCA
AACATGCCGGTCGATCAGATCCAGCGCCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATACCCGGCATTCCATTGCGTGCCCTGATGGTGGCTCCCCGCCAGCTTCC
TTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGACAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA