SecReT6
Protein ID: 386698720
SecReT6 ID636
T6SS typei1
Gene symbol-
Locus tagKO11_01080
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]252884..253408 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDE8YBR4
KEGG IDeko:EKO11_3696, ekf:KO11_01080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|386698720|ref|YP_006162557.1| putative lipoprotein [Escherichia coli KO11FL]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c253408-252884 Escherichia coli KO11FL chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGTGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACCGAACCGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCTGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA