SecReT6
Protein ID: 386698721
SecReT6 ID636
T6SS typei1
Gene symbol-
Locus tagKO11_01085
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]253405..254685 [-]
Producttype VI secretion system protein ImpI
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|386698721|ref|YP_006162558.1| type VI secretion system protein ImpI [Escherichia coli KO11FL]
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVILHDGTFCLRP
QTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLST
EGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMD
LPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQ
RNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRV
LLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c254685-253405 Escherichia coli KO11FL chromosome, complete genome
ATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCAGTGAGCTGGAAAGCGGACGGG
CGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGGCCCCGAATGCCACTGGTCGGTACAGGA
TCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGATGGCACATTTTGTCTGCGCCCG
CAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAGACCTAATACAGTTGCGCCAGG
GCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTCCCCATTACGA
TGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCTGCTATCAACG
GAGGGTACGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTAAACGGTTTTT
CTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTTCAGGCATTGC
GGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCCGTTTATGGAT
CTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTGCGGCAGAAATGGCGCAACGCC
ACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCATGAGCAATTCCGACGATGCGGA
TGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTTGCAGCAGCAG
CGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAACATGGATTACG
CCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCGCCGCCGTCAG
TGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCGATTGTGGAGTCGCTTCGTGTC
CTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGCCATGAACTGC
GCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGGCCTCCGATCG
CCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAAGTCTATGACCGGGTGCTTCGTGAAAAA
CAGCGGGAGCCGGAAGCATGA