SecReT6
Protein ID: 386698730
SecReT6 ID636
T6SS typei1
Gene symbol-
Locus tagKO11_01130
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]261741..263882 [+]
ProductVgrG protein
NoteTssI
UniProt IDE8YBQ5
KEGG IDekf:KO11_01130, eko:EKO11_3687
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-62, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 6.10E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|386698730|ref|YP_006162567.1| VgrG protein [Escherichia coli KO11FL]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYLTIWQGDDVQR
RVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASDLHGEQPQAVPGRRGSGTTLDNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQESSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHHENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|386698504|ref|NC_017660.1|:261741-263882 Escherichia coli KO11FL chromosome, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTTTTTTCCCTCGATCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTCCAGCAGATCCTCGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTATGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTGTGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGCTGTTCAGCGAGCCACAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTGAGCACCCTCTGC
ATCAGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGTGCCCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCGCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCGAGCGATCTTCACGGCGAACA
GCCGCAGGCGGTACCGGGACGCAGGGGTTCAGGCACCACGCTGGATAACCACTTTGCGGTAATCCCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGAAAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGCTTTGGT
AACCTGGCGATACCGCGTGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TCATTATGGGGCGTACCTACCACCATGAAAACCGCACCCCCGGCAGCCTGCCGGGGACGAAGACGCAGAT
GACGATCCGCTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACTGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTGGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGA
CGGTAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTGGGGAATAACGTCACCTTCTCGGTGGGCAAGACAATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTCAATGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA