SecReT6
Protein ID: 386700243
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08735
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1857830..1858258 [-]
Producthypothetical protein
NoteTssE
UniProt IDE8Y7A6
KEGG IDeko:EKO11_0927, ekf:KO11_08735
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-16, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|386700243|ref|YP_006164080.1| hypothetical protein KO11_08735 [Escherichia coli KO11FL]
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1858258-1857830 Escherichia coli KO11FL chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTGTTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA