SecReT6
Protein ID: 386700246
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08750
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1859822..1861582 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDE8Y7A9
KEGG IDeko:EKO11_0930, ekf:KO11_08750
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-182, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386700246|ref|YP_006164083.1| type VI secretion system protein ImpG [Escherichia coli KO11FL]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCFYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYLNAGSPVACALHRALTLGTQQFWLRLPGQDR
RTLDAHFSPLGFEDNDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLELVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDADRMLEDETLSLSLTGTNGHLPR
KALQSTLLDRPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1861582-1859822 Escherichia coli KO11FL chromosome, complete genome
ATGGACGACTTAACCCAACGCTACTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCCGCGATGCTCAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
ACGCCTGTTCGAAGGCTTTGCTTTTTTAATGGGCAGCCTGCGCGAGAAGCTGGACGACGATCTGCCGGAG
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCTCACTACCTGCGAACTATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGTTTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGTTCGGTTATTCGTCTGCGCTTTGAATGCGGCCCGC
TGGTCGGTGACTGGTCACAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGGCAGTCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGTTGCGTCTGCCGGGGCAGGATCGC
CGGACGCTTGACGCACACTTTTCCCCGTTGGGCTTTGAGGATAATGACAGGCTCTGGCCAAAAGGCGAGT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTGGCACT
CAACGGGCTTGAGCTGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAATCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGTCTGCATGACACCTGGCTGATTCTGGGCGGTGATGCGTTTGA
TGCTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCATCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATAGGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCAACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGAACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCTACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA