SecReT6
Protein ID: 386700254
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08790
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1865242..1866600 [-]
Producthypothetical protein
NoteTssA
UniProt IDE8Y7B2
KEGG IDeko:EKO11_0935, ekf:KO11_08790
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 1..42
ImpA-rel_N [PF06812], Evalue: 3.30E-12, Aligned region: 375..393
Protein Sequence: 452 a.a.     [Download]
>gi|386700254|ref|YP_006164091.1| hypothetical protein KO11_08790 [Escherichia coli KO11FL]
MRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAK
EDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSSIPAASSPVDAPQVQ
TITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYA
QQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLLERLPGLENLAWNDG
TPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGVEAALGWIQTRPGIT
TARQRLLLRLLMARVAEQYGKNEMALLLLEELDTVAQGLTLTQWEPDLLFEVKARQLKLLRLRAHRYADK
ALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1866600-1865242 Escherichia coli KO11FL chromosome, complete genome
GTGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGC
TGGCGCTACTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAA
AATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAA
GAGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAAC
AACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAA
CGCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAG
ACCATCACCTCCGGGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGC
AGGGCTGGCTTTCGGCACACCGGCTGATGAAAACCCTGCGCTGGGACACAGTGCATGAACTGCCGCCGGA
TGTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCG
CAGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGC
TGGATATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGT
TATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGC
ACACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCAT
GGCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGC
ACTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCTCTGGGCTGGATACAGACCCGTCCGGGCATCACC
ACGGCACGCCAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAAA
TGGCGCTCCTGCTGCTGGAAGAACTGGATACCGTCGCACAGGGGCTGACGCTGACGCAGTGGGAGCCGGA
CCTGCTGTTTGAGGTAAAAGCCCGACAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCGGATAAA
GCCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGACAATCGATCCGGTACGGGCAGCGG
TATTGTGTGATACGCAACATAAGGACTGA