SecReT6
Protein ID: 386700258
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08810
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1868625..1870262 [-]
Producthypothetical protein
NoteTssA
UniProt IDE8Y7B5
KEGG IDekf:KO11_08810, eko:EKO11_0939
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 75..135
Protein Sequence: 545 a.a.     [Download]
>gi|386700258|ref|YP_006164095.1| hypothetical protein KO11_08810 [Escherichia coli KO11FL]
MRKNTGKTPMSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMN
AVVPQNSSSIPAASSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLVPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LEMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1870262-1868625 Escherichia coli KO11FL chromosome, complete genome
ATGCGGAAGAATACGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AAATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCT
GGCGCTGCTGGCCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAACA
ACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGTCCCGCCGCGCACCGAGTCACGCAATCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACTGGCGTCAGCCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCGGTT
ATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CTGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACTGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCGGAA
CTGCTGTTTGAGGTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCTGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTAACAATCGATCCGGTACGGGCAGCGGT
ACTGTGTGATACGCAGCATAAGGAGTGA