SecReT6
Protein ID: 386700266
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08850
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1880296..1882782 [-]
Productputative VGR-like protein
NoteTssI
UniProt IDE8Y7C2
KEGG IDekf:KO11_08850, eko:EKO11_0947
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-61, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 3.30E-46, Aligned region: 606..743
T6SS_Vgr [PF13296], Evalue: 1.70E-33, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 3.50E-14, Aligned region: 392..473
Protein Sequence: 828 a.a.     [Download]
>gi|386700266|ref|YP_006164103.1| putative VGR-like protein [Escherichia coli KO11FL]
MGIQNFDHSHHKLKIRGQQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNLTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMADIISELNGLSDKIQKLSDDATMANADPADMAAQIALITSRINDLTAPVILMHAPKGVAVASGEHL
QLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIKLIANKGAVSVQAQHDLMELLAKKSIEIV
STEDEIRISAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKAVHYGRQPGAKLKQEMMAFPMIESGEFNT
RFFFTDDNDIPYANTKYIARLPDGTTKDGITSDDGRSEIFFSDKDGEILIHLFVEQDK
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1882782-1880296 Escherichia coli KO11FL chromosome, complete genome
ATGGGTATTCAGAATTTCGACCACTCGCACCACAAGCTCAAAATTCGCGGCCAGCAAAGTCCGGTGGATG
TGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGATATCCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCCCCCCTGCGCACCCTGTACGGGGTCATTACCGGTTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTGGAGCCGCGTATGGCGCTGCTGGCCCGCAGCCGCCAGAA
TGCCATCTACCAGAATCTGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCCGGTGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACACGACTC
GGCACACACTGACCATGTGACCATCCAGAACTACAAGCGCAACGTTCTGCGCACCCCTGCCAATAACAAA
ATCCGGCTGGATGATGAGCGCGGTAAAGAGCATATCAAGGTCAGTACCGAATATGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTTGTTGATGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGTGCGGTGCGGGCAAAGAAAGGCATCTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGTCAG
GTCAGAGAGATGGCCGACATTATCAGCGAACTGAACGGCCTGAGCGATAAAATCCAGAAACTGTCCGATG
ACGCGACGATGGCGAACGCCGACCCGGCGGATATGGCCGCGCAGATAGCATTGATAACCAGCCGGATAAA
CGACCTGACCGCCCCGGTGATTTTGATGCACGCGCCGAAAGGTGTGGCGGTCGCCAGCGGCGAGCACCTG
CAACTGGCAGCGGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGGCGTGGTGAAGAATA
TGTTTATCGGCGTGGGGCGGGCGCTGAGCGTGTTTGTGCGCAAGGCGGGTATCAAACTGATTGCCAATAA
AGGCGCAGTATCGGTACAGGCGCAGCACGATTTGATGGAGTTACTGGCGAAGAAGTCGATAGAGATCGTC
AGTACCGAAGATGAGATCAGGATTTCAGCGAAGAAAAAAATAACGATTAATGGCGGTGGAAGTTATATCC
GGATTGAGGGTAGCGGCATTGAGCCAGGAACGCCGGGGGATTATAACGTCAAAGCGGTGCATTATGGGCG
TCAGCCGGGAGCGAAGCTGAAACAGGAAATGATGGCGTTTCCGATGATTGAATCTGGAGAATTTAATACC
CGTTTCTTTTTTACAGATGATAATGATATTCCTTATGCAAACACCAAATATATAGCAAGATTACCAGATG
GTACAACAAAAGACGGCATTACAAGCGATGATGGTCGATCAGAAATATTTTTTTCTGATAAGGATGGGGA
AATATTAATACATCTATTTGTCGAGCAGGATAAATAA