SecReT6
Protein ID: 386700267
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08855
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1882794..1885439 [-]
ProductATPase
NoteTssH
UniProt IDE8Y7C3
KEGG IDeko:EKO11_0948, ekf:KO11_08855
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-39, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 3.00E-39, Aligned region: 512..534
AAA_2 [PF07724], Evalue: 3.00E-39, Aligned region: 609..774
AAA [PF00004], Evalue: 9.90E-18, Aligned region: 22..57
AAA [PF00004], Evalue: 9.90E-18, Aligned region: 240..352
AAA [PF00004], Evalue: 9.90E-18, Aligned region: 614..737
AAA [PF00004], Evalue: 9.90E-18, Aligned region: 763..779
ClpB_D2-small [PF10431], Evalue: 1.90E-14, Aligned region: 392..411
ClpB_D2-small [PF10431], Evalue: 1.90E-14, Aligned region: 780..855
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 613..732
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 487..558
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 596..649
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 4.60E-11, Aligned region: 753..805
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 240..300
AAA_25 [PF13481], Evalue: 1.40E-07, Aligned region: 609..642
Clp_N [PF02861], Evalue: 4.30E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 4.30E-07, Aligned region: 108..124
AAA_22 [PF13401], Evalue: 5.60E-06, Aligned region: 39..79
AAA_22 [PF13401], Evalue: 5.60E-06, Aligned region: 239..325
AAA_22 [PF13401], Evalue: 5.60E-06, Aligned region: 468..514
AAA_22 [PF13401], Evalue: 5.60E-06, Aligned region: 610..650
Arch_ATPase [PF01637], Evalue: 1.00E-05, Aligned region: 218..389
Arch_ATPase [PF01637], Evalue: 1.00E-05, Aligned region: 684..695
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 237..262
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 609..635
NACHT [PF05729], Evalue: 3.80E-05, Aligned region: 112..135
NACHT [PF05729], Evalue: 3.80E-05, Aligned region: 240..332
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 498..531
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 613..631
Sigma54_activat [PF00158], Evalue: 0.00061, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 0.00061, Aligned region: 612..730
Sigma54_activat [PF00158], Evalue: 0.00061, Aligned region: 763..797
Zeta_toxin [PF06414], Evalue: 0.0028, Aligned region: 233..270
Zeta_toxin [PF06414], Evalue: 0.0028, Aligned region: 604..653
AAA_17 [PF13207], Evalue: 0.0042, Aligned region: 240..342
AAA_17 [PF13207], Evalue: 0.0042, Aligned region: 612..648
Protein Sequence: 881 a.a.     [Download]
>gi|386700267|ref|YP_006164104.1| ATPase [Escherichia coli KO11FL]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRSVRERPQLSEPLTALIRQAWLIASLEGDDPQIRSQHLLMALTEKPMLPACNDLWVLLSLS
RVQLERLRPLLDAQSDECPARQPQVTEPLTSAQPEAATTDAPAKTLTGKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVHIRTLDLG
LLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLQARLTALDIEREAIEQDSVFYPEASPERLAELTDLRDE
LQAEAGHLEAQYQQEKALAQQIMTLRQEGTDSTELQQQLRAHQGFAPLLALDVDARAVATVVADWTGIPL
SSLLKDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTVKTETALTL
ADTLFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMN
LFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLREHFQPALMA
RFQTVIYRPLGQEAMRAIVEMKLAQVVRRLRQHYGLETEINDSLYDALTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAAHHKPAQLRLGWDEEDGIVLEFATEEMQ
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1885439-1882794 Escherichia coli KO11FL chromosome, complete genome
ATGACCGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCGTACTGTGCACGGGCGCTGGACGCTG
CCGCCTCACTGTGTCAGACCCGCGCCCATGCGGAGATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCTCGGTCCGCGAACGTCCGCAGCTTTCTGAACCCCTGACGG
CGCTTATCAGGCAGGCGTGGCTGATTGCCTCGCTGGAAGGCGACGACCCGCAAATCCGCAGTCAGCACCT
GCTGATGGCGCTGACAGAAAAACCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGCCTGAGC
CGTGTGCAGCTTGAGCGGCTGCGTCCCCTGCTGGATGCGCAGTCGGATGAATGTCCGGCACGTCAGCCAC
AGGTCACCGAACCGCTGACATCCGCGCAACCAGAGGCGGCAACGACGGACGCACCGGCAAAAACGCTGAC
GGGGAAACAGGATGACGCCCTGCTGGCGGTGCTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGAATCGACCCGGTATTCGGGCGCGACACGGAAATTCGCCAGATGGTCGATATCCTCTCACGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGGGTGGGCAAAACCGCGCTGGTGGAAGGGCTGGC
GCTGCGTATCGCCGAAGGCAACGTGCCGGACAGCCTGAAAACGGTGCATATCCGCACACTGGACCTCGGT
CTGTTACAGGCTGGCGCGGGTGTTAAAGGTGAATTTGAACAGCGGCTGAAAAATGTCATCGATGCAGTGC
AGAAATCACCGGAGCCGGTACTGCTGTTTATTGATGAAGCCCATACCATTATCGGTGCGGGTAATCAGGC
AGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCGCTGGCAAGGGGCGAACTGCGCACCATCGCCGCC
ACAACGTGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAACGCCGCTTCCAGATGGTGA
AAGTCGACGAGCCGGATGATGACACCGCCTGCCTGATGCTGCGGGGACTCAAGGCCCGCTATGCACAGCA
CCACGGCGTACATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTATCTGACCGGA
CGCCAGTTGCCGGACAAGGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGAGCCTCGACA
CCCTGCCGGAACCGTTGACGCAGCTTCAGGCGCGTCTGACCGCGCTGGATATTGAGCGGGAAGCAATTGA
GCAGGACAGCGTGTTTTATCCCGAAGCCAGCCCGGAGCGGCTGGCGGAACTGACCGATTTGCGTGATGAG
CTGCAGGCAGAAGCCGGGCATCTGGAAGCGCAGTATCAGCAGGAAAAGGCACTGGCGCAGCAGATTATGA
CGTTGCGTCAGGAAGGGACAGACAGCACTGAACTGCAACAGCAACTGCGAGCGCATCAGGGCTTTGCTCC
GTTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCCACGGTGGTGGCGGACTGGACCGGCATCCCGCTC
TCTTCGCTGCTCAAGGACGAGCAGAGCGACCTGCTCAGTATGGAACAAAGCCTTGAAAACCGCGTTGTCG
GGCAAAGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCACGCCGGAGAA
TGGCCCGCAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGTTAAAACCGAAACTGCGCTCACACTG
GCCGACACCCTGTTTGGCGGTGAAAAATCCCTTATCACCATCAACCTCTCCGAATATCAGGAGCCGCATA
CCGTCTCCCAGCTTAAGGGGTCTCCTCCGGGCTACGTTGGCTACGGTCAGGGCGGCGTACTTACCGAAGC
CGTTCGCAAACGCCCGTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCACCGCGACGTAATGAAC
CTGTTCTATCAGGTGTTTGACCGGGGTTTTATGCGCGACGGCGAAGGGCGGGAAATTGACTTCCGCAACA
CCGTGATTCTGATGACGGCTAATCTGGGCAGCGACCACATCATGCAGCTGCTGGAGGAAAAACCGGACGC
CACAGACGCAGACCTGCATGAACTGCTGTATCCCCTGCTGCGCGAGCACTTCCAGCCTGCACTGATGGCG
CGTTTTCAGACGGTGATTTACCGCCCGCTGGGACAGGAAGCGATGCGCGCCATTGTGGAAATGAAACTGG
CGCAGGTGGTTCGTCGTCTTCGTCAGCACTATGGGCTGGAAACGGAAATCAACGACAGCCTGTACGACGC
CCTGACCGCCGCCTGCCTGCTGCCGGACACCGGTGCGCGTAATATCGACAGCCTGCTGAACCAGCAAATC
CTGCCGGTCTTAAGCCAGCAGTTGCTGGCACAGCAGGCTGCGCACCATAAGCCAGCCCAACTACGGCTTG
GCTGGGATGAGGAAGACGGGATTGTACTGGAGTTCGCTACGGAAGAGATGCAATAA