SecReT6
Protein ID: 386700270
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08870
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1887844..1888509 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDE8Y7C6
KEGG IDeko:EKO11_0951, ekf:KO11_08870
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-48, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386700270|ref|YP_006164107.1| type VI secretion system protein ImpK [Escherichia coli KO11FL]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1888509-1887844 Escherichia coli KO11FL chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGTCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTTAGCCGGGAGAGCGTGGAGCACATTACCTACGCGCAGTGCGCCCTG
CTGGACGAAACAGTCCTGAGTCGCAGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCAGGCGAGCTGCTGTACGAGCGGATGAAGCAGGTGTTGCAGGA
GCCCGCGCCTGCACAGGCTGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGTGGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCTGGTCGCGCCATTTGGCG
TACTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTAACGCTGACGCTGCTACTGGCCGGTGTCTGGTGGGGGCTGCACCACTGGCTGAACGTG
CTGGTGGATGAATTGCTGCCGCAAAGCCTGCGGTAA