SecReT6
Protein ID: 386700272
SecReT6 ID637
T6SS typei2
Gene symbol-
Locus tagKO11_08880
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_017660] [Browse all T6SS(s) in this replicon]
Location [Strand]1889861..1891399 [-]
Producthypothetical protein
NoteTssC
UniProt IDE8Y7C8
KEGG IDekf:KO11_08880, eko:EKO11_0953
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386700272|ref|YP_006164109.1| hypothetical protein KO11_08880 [Escherichia coli KO11FL]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGENVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFSNLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386698504|ref|NC_017660.1|:c1891399-1889861 Escherichia coli KO11FL chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTGACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACACTGGCGGATGCCTCACCCGATGAGCGCGTGACAGCGGCGATTCACGTTCTACTTTCCTGT
CTGGCGAAATCAGGCGAGAACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATTTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCATCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAATCGTTTCGTGATACCGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTATCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAAGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTTCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCCTATATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGTAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA