SecReT6
Protein ID: 386707942
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01040
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]240399..240881 [-]
ProductHcp-like protein
NoteTssD
UniProt IDE0J669
KEGG IDelw:ECW_m0217, ell:WFL_01040
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-31, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|386707942|ref|YP_006171663.1| Hcp-like protein [Escherichia coli W]
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELIITKPVDKSSP
LLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDI
SWEHTLAGTNAMSKWQDRVQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386707734|ref|NC_017664.1|:c240881-240399 Escherichia coli W chromosome, complete genome
ATGGCAAATATAAGTTATTTATCTTTGAGTGGAGAGACACAAGGGCTGATTTCAGCAGGTTGCTCAACGC
TTGATTCTGTCGGAAACAAAGCGCAGCCAGAACATAAAGATCAGATCATGGTTTATGCGTTAATGCATTC
CATCTCAAGAAGTCAAAATGTCAATCATCATGAATTAATTATCACCAAACCGGTTGATAAATCCTCACCA
TTGCTGGCAAAAGCACTTAGTGACAATGAAAAAATGGCAATATGTGAATTTATACTCTACCGAACCAGTA
AAGCGGGTATTTACCAGCCTTATTATAAAATAAATCTGTCAAAAGCCCGAATATCAAGTATTGATTTTGT
CACACCGCATGCTGTCCTGGAAAAAGAACTGGAACCACAGGAGAGAATTGCCTTTATTTATGAAGATATT
TCCTGGGAGCATACGTTAGCCGGTACGAATGCAATGAGTAAATGGCAGGATCGTGTACAGTAA

Protein ID: 386707959
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01125
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]261013..261531 [+]
Producthypothetical protein
NoteTssD
UniProt IDE0J653
KEGG IDell:WFL_01125, elw:ECW_m0233
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|386707959|ref|YP_006171680.1| hypothetical protein WFL_01125 [Escherichia coli W]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|386707734|ref|NC_017664.1|:261013-261531 Escherichia coli W chromosome, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAGGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA