SecReT6
Protein ID: 386707945
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01055
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]245811..247223 [-]
Producthypothetical protein
NoteTssA
UniProt IDE0J666
KEGG IDell:WFL_01055, elw:ECW_m0220
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 152..184
Protein Sequence: 470 a.a.     [Download]
>gi|386707945|ref|YP_006171666.1| hypothetical protein WFL_01055 [Escherichia coli W]
MAMDLRDPNVWVSHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQRRGLVILASES
KDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATA
QRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQP
SAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSAD
MVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGL
LFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|386707734|ref|NC_017664.1|:c247223-245811 Escherichia coli W chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGGTATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATC
GCTGGCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGGGGGCTGGTCATTCTGGCTTCGGAGAGT
AAGGATTTTCGTCTGCTGGCGCATCTGCTGAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGTCAGGGGAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAAC
TGGCACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTG
GCAGAACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGAT
ATGGTGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCG
TACTGCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAA
ACAGGTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCA
GGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCAC
GGCAGAACAATAA