SecReT6
Protein ID: 386707955
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01105
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]258030..259505 [-]
Producthypothetical protein
NoteTssC
UniProt IDE0J656
KEGG IDell:WFL_01105, elw:ECW_m0230
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-188, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|386707955|ref|YP_006171676.1| hypothetical protein WFL_01105 [Escherichia coli W]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|386707734|ref|NC_017664.1|:c259505-258030 Escherichia coli W chromosome, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTATCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGTTTCGGACAGTTTGGCGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCGCCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCCTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATTACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGTC
CGCAAAGCGGCGGCGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGA
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCA
AACCTCTGCGCGCTGCCAAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCT
AAGCGTGAGACCTCATTTTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA