SecReT6
Protein ID: 386707957
SecReT6 ID638
T6SS typei1
Gene symbol-
Locus tagWFL_01115
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]259815..260315 [-]
Producthypothetical protein
NoteTssB
UniProt IDE0J654
KEGG IDelw:ECW_m0232, ell:WFL_01115
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|386707957|ref|YP_006171678.1| hypothetical protein WFL_01115 [Escherichia coli W]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386707734|ref|NC_017664.1|:c260315-259815 Escherichia coli W chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACCCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA