SecReT6
Protein ID: 386707961
SecReT6 ID638
T6SS typei1
Gene symbolrhsW1
Locus tagWFL_01135
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]263958..268007 [+]
ProductRhs core protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 229..243
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 352..384
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 434..472
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 459..492
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 498..537
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 542..577
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 584..620
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 626..661
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 667..697
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 701..718
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 729..762
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 784..806
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 823..834
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 852..860
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 875..906
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 955..992
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1007..1018
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1040..1053
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1157..1175
RHS_repeat [PF05593], Evalue: 2.00E-64, Aligned region: 1160..1186
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 369..382
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 624..635
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 955..963
RHS [PF03527], Evalue: 3.90E-20, Aligned region: 1154..1194
Protein Sequence: 1349 a.a.     [Download]
>gi|386707961|ref|YP_006171682.1| Rhs core protein [Escherichia coli W]
MGGKPAARQGDMTRKGLDIVQGSAGGLIGAPTGVACSVCPGGITYANPVNPLLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDSGGRSIHFEPLFPGEISYSRSESLW
LARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLAFHRAAKGDVAGAVTGVTDGAGRRFHLALTTQAQRAEAFRKQRASSLSSPASPRSVSSSQ
VFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFAYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYRLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPD
GLRSSREYDERGRLTAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLAFTDCSGYTTR
YEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIIAPDGSRSETQYDAWG
KAISTTQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDE
GLITLWHYDASDRITRRTVNGEPAEQWQYDDHGWLTEISHLSEGHRVAVHYGYDDKGRLTGERQTVENPE
TGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSFGSM
AGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTLAPD
LDIRIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPAGVIRTDDERT
HHYHYDSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRL
TTVQTQQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRAG
AVSAESEAWLAQCGLTAEQMAAQMEDAYIPERRLHLYHCDHRGLPLALISPEGETAWCGEYDEWGNQLNE
ENPHHLYQPYRLPGQQHDEESGLYYNRNRYYDPLQGRYITQDPIGLEGGWNLYIYPLSPVMNIDPMGLSV
MAPALSMQNLSALLKSKMESTISSCNGESSGYLLTCQTAYDSDCGEIHERCMMLCKTAQIDPDMSHIWGG
SLFGCLNGCLPARCGGNAV
 
Nucleotide Sequence: 4050 bp     [Download]
>gi|386707734|ref|NC_017664.1|:263958-268007 Escherichia coli W chromosome, complete genome
ATGGGCGGAAAACCGGCGGCGCGGCAGGGTGATATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CGGGGGGGCTGATAGGTGCGCCGACGGGAGTGGCCTGTTCGGTATGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGCTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAGCGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCACTCTGG
CTGGCGCGGGGCGGAGTAGCGGCGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATGTGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAG
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGACGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCAGCTAAGGGTGACGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGCGCTGACCACGCAGGCGCAGCGGGCGGA
AGCCTTCCGTAAACAGCGCGCCTCTTCCTTATCTTCCCCGGCCAGTCCCCGTTCTGTTTCCTCTTCTCAG
GTTTTCCCCGACACGCTGCCCGCCGGTACAGAGTACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTAT
GGCTGACACACGACCCGGCATACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTACACGTACACGGC
CGGTGGTGAACTGCGGGCGGTGTATGACCGCAGCGGAACGCAGGTGCGCGGGTTTGCTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCGCACCATTATGCGGGGAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GCCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAGGGCGAGGGCGGCCTGAAGCGGGTGGTG
AAGAAGGAGCATGCCGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCGCAGA
CGGATGCGGCGGGGCGGCGGACGGAGTACCGGCTGCATATGGCGTCGGGCGCGGTGACAGCGGTGACGGG
GCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACGTACCCGGAC
GGGCTTCGCAGCAGCCGGGAGTATGATGAGAGGGGAAGGCTGACGGCGGAGACCTCGCGCAGCGGTGAGA
CAACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTAC
AAAACAGATGGCATGGAGCCGTTACGGTCAACTGCTGGCCTTCACGGACTGCTCGGGGTACACGACGCGG
TATGAGTACGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAGGAAGGCATCAGCACTTACAGCAGTT
ATAACCCGCGTGGGCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGGGAGACCCGTTATGAGTACAGTGC
CGCAGGCGACCTCACCGCTATCATTGCCCCGGACGGTAGCCGCAGTGAGACACAGTATGATGCGTGGGGT
AAAGCCATCAGCACCACGCAGGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCG
TGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTGGACAGGCTGACTGAACAGCG
CGGCTTTGACGGCCGGACGCAACGTTACCATTATGACCTGACCGGAAAACTCACGCAGAGTGAAGATGAG
GGGCTTATCACCCTCTGGCATTACGATGCGTCGGACCGTATCACCCGGCGCACGGTGAACGGTGAACCGG
CGGAGCAGTGGCAGTATGACGACCACGGCTGGCTGACAGAAATCAGCCACCTGAGTGAAGGCCACCGTGT
GGCGGTCCACTACGGCTATGACGATAAAGGCCGCCTGACGGGCGAACGGCAGACGGTGGAGAACCCGGAG
ACGGGGGAGATGCTGTGGGAGCATGAGACGGGGCATGCGTACAGCGAACAGGGGCTGGCGACCCGTCAGG
AGCCGGACGGTCTGCCGCCGGTGGAGTGGCTGACATATGGCAGCGGTTATCTTGCGGGGATGAAGCTGGG
CGGAACGCCGCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGAGACGGTGCGCAGCTTCGGCAGCATG
GCAGGCAGTAATGCCGCATATGAACTGACCAGCACATACACCCCCGCAGGCCAGTTACAGAGCCAGCACC
TGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCATCAGCGGTCC
GCGACAGACGCGGGAATACGGCTACAGCGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTCGCACCGGAC
CTGGACATCCGCATCCCGTATGCGACCGACCCGGCGGGAAACCGGCTGCCGGACCCGGAGCTACACCCGG
ACAGCACGCTCACGGCGTGGCCGGATAACCGCATCGCAGAGGATGCGCACTATGTTTACCACTATGATGA
ATACGGCAGACTGACGGAGAAGACGGACCGCATCCCGGCGGGTGTGATACGGACGGACGACGAGCGGACC
CACCACTACCACTACGACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCGAGCCGCAGG
TGGAGAGCCGCTATCTCTATGACCCGCTGGGCCGCCGGACGGGAAAACGGGTGTGGCGGCGGGAGCGTGA
CCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGAGACCTGGTACGGGTGGGACGGTGACAGGCTG
ACCACTGTACAGACCCAACAGACAAGAATCCAGACGGTATACCAGCCGGGAAGCTTCACGCCGCTCCTGA
GAATCGAAACAGAGAATGGCGAACAGGCGAAGGCGCGGCACCGTAGCCTGGCGGAGGTGTTGCAGGAGGA
CACGGGTGTGACGCTACCGGCGGAGCTGGCGGTGATGCTGGGAAGGCTGGAGCGGGAACTGCGCGCGGGA
GCGGTGAGTGCGGAGAGTGAGGCATGGCTTGCGCAGTGCGGACTGACGGCGGAACAGATGGCCGCGCAGA
TGGAGGATGCATACATCCCGGAGCGGAGGCTGCATCTTTACCACTGCGACCACCGGGGACTGCCGCTGGC
GCTCATCAGCCCGGAAGGGGAAACGGCGTGGTGCGGAGAGTATGATGAGTGGGGCAACCAGCTTAATGAG
GAGAACCCGCATCACCTGTATCAGCCATACCGTCTGCCGGGGCAGCAGCATGATGAGGAGTCGGGGCTGT
ACTACAACCGGAACCGGTACTATGATCCGTTGCAGGGGAGGTATATCACCCAGGATCCCATTGGGCTGGA
GGGGGGATGGAATTTATACATTTATCCGTTGAGTCCGGTTATGAACATTGATCCGATGGGGCTATCTGTT
ATGGCTCCAGCATTGTCAATGCAAAACTTATCCGCATTACTTAAAAGTAAGATGGAATCGACAATTTCGT
CTTGTAACGGGGAATCATCTGGATATTTATTAACCTGCCAAACAGCATACGATAGTGACTGCGGAGAAAT
ACATGAGCGGTGTATGATGTTATGTAAAACTGCACAAATAGATCCAGATATGTCACACATTTGGGGCGGT
TCTCTTTTTGGGTGTCTAAATGGTTGTCTACCTGCTCGATGTGGTGGAAATGCCGTATAA