SecReT6
Protein ID: 386710670
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14775
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3097972..3098472 [+]
Producthypothetical protein
NoteTssB
UniProt IDE0J232
KEGG IDelw:ECW_m3028, ell:WFL_14775
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|386710670|ref|YP_006174391.1| hypothetical protein WFL_14775 [Escherichia coli W]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLSGSGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3097972-3098472 Escherichia coli W chromosome, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCTGTTGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGTGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGACACACTAAGCGGAAGCGGTAATGAGCAAAATATCGCGCTTG
AATTTAAAAGCCTGAAAGATTTTGAACCCGAACAGGTAGCAAAAAATATCCCACAGCTTCGTGTATTACT
CGCTATGCGCAATTTATTACGTGACCTGAAATCCAATCTGTTAGATAACGCAACGTTTCGACGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA