SecReT6
Protein ID: 386710671
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14780
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3098531..3100069 [+]
Producthypothetical protein
NoteTssC
UniProt IDE0J231
KEGG IDelw:ECW_m3029, ell:WFL_14780
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386710671|ref|YP_006174392.1| hypothetical protein WFL_14780 [Escherichia coli W]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGENVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFSNLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3098531-3100069 Escherichia coli W chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTGACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACACTGGCGGATGCCTCACCCGATGAGCGCGTGACAGCGGCGATTCACGTTCTACTTTCCTGT
CTGGCGAAATCAGGCGAGAACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATTTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCATCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAATCGTTTCGTGATACCGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTATCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAAGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTTCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCCTATATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGTAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA