SecReT6
Protein ID: 386710672
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14785
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3100087..3101424 [+]
Producthypothetical protein
NoteTssK
UniProt IDE0J230
KEGG IDell:WFL_14785, elw:ECW_m3030
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|386710672|ref|YP_006174393.1| hypothetical protein WFL_14785 [Escherichia coli W]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALELGSLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVSLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRA
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3100087-3101424 Escherichia coli W chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGATGTCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCTGACGTGAGCGATGTTCTGCCTCTCGCCTGCGATCTGCACGCGCTGACGAACG
ACAGCGCGGTTGTTCTGCTGGCGCTGCCGCTTGCCCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTACGCTATCGTCAGGAATGGCAAAAGGTACAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGTTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGACTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGTCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGTTGCTTAACGCGCTGAACTCCGCCGAGCCGGTGCTGAGTGATTTCCTGCGCTACCCGGC
GGTTCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGGGCGCTGCTGACATTTTCCCTTGAA
CATAACGTCAGCGCCGTCCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCACTGGAGCTGGGATCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTTCACTGGTGCCACTGACCTCAGTTCCGGCGGCGCT
GCCGCTGCGACTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCAGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCGCATGA